PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009339-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 369aa    MW: 40914.9 Da    PI: 6.5219
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009339-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +++++G+g +W + ++++g++R++k+c++rw++yl
    NNU_009339-RA 14 KGPWSPEEDAMLKAYIEKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.45.8e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    NNU_009339-RA  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.614962IPR017930Myb domain
SuperFamilySSF466893.59E-2711109IPR009057Homeodomain-like
SMARTSM007173.8E-131364IPR001005SANT/Myb domain
PfamPF002496.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241569IPR009057Homeodomain-like
CDDcd001675.59E-101662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.4E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370117IPR009057Homeodomain-like
CDDcd001674.64E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAMLKAYIE KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKETQTRRLS SALNLDPKVT NGMEDNPALS NSALERLQLH MQLQSLQSPF SFYNNAALWP  180
KLHPFGGRIF PNNHVANDDP TSLMQEGATT QAGTSQKVAL DELPTAPIGV QQDNLASSLS  240
KQAKLENSLN GFSSSESSIA FSNGSVPIDT TIMSQLNSVD KSNRNLQSVS AGLYAELNEL  300
LYGKNCGYVP NEDQITEFDG FKETEAVKDS MPWWANDFDT KSSSSNSWDS ASVLQPDGLF  360
PDYVLGYDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259776.10.0PREDICTED: myb-related protein 306
SwissprotQ9FKL21e-102MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A061GXE31e-161A0A061GXE3_THECC; Myb domain protein 36
STRINGPOPTR_0018s10390.11e-154(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-85myb domain protein 36